PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_107170_psah.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 397aa    MW: 42142.5 Da    PI: 6.1917
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_107170_psah.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_164.91.4e-20299361163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         e+e+kr+rrkq+NRe+ArrsR+RK+ae++eL++++++L++eN  L++el++ +  +++l +e+
  Bv5_107170_psah.t1 299 EREIKRQRRKQSNRESARRSRLRKQAECDELAQRAEALKEENANLRSELSRFRSDYEQLMAEN 361
                         89*********************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077778.0E-30195IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165965.4E-49134266No hitNo description
Gene3DG3DSA:1.20.5.1703.3E-16292358No hitNo description
PfamPF001706.1E-19299361IPR004827Basic-leucine zipper domain
SMARTSM003381.2E-21299363IPR004827Basic-leucine zipper domain
PROSITE profilePS5021713.024301364IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-10302358No hitNo description
CDDcd147025.70E-23304349No hitNo description
PROSITE patternPS000360306321IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGSSETDKTP KEPKTPAPIT TQEQSSATST ATVNAEWSGF QAYSPIPPHG FMASNPQAHP  60
YMWGVQHIMP PYGTPPHPYV AMYPHGGLYA HPSMPPGSYP FSPFAMPSPN GIADAPGNIP  120
ASTEADGKHP EGKEKLPIKR SKGSLGSLNM ITGKNNEEGK TTGPAANGAC SKSADSGSDG  180
SSEGSDANSQ NDSGGREEAQ EADASQSGNS AHVAQNGVLN APHMVNHAMA MVPMTAPGAP  240
ASVPGPATNL NIGMDYWGAP ASSPIPAMRG KVPSAPIATG IVPAGSRDNL QSQLWLQDER  300
EIKRQRRKQS NRESARRSRL RKQAECDELA QRAEALKEEN ANLRSELSRF RSDYEQLMAE  360
NTALKERLGE IPEDLGSNRA GQPLVSETQE SSKTDQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1315321RRSRLRK
2315322RRSRLRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00291DAPTransfer from AT2G35530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677384.10.0PREDICTED: transcription factor HBP-1a
SwissprotQ501B21e-161BZP16_ARATH; bZIP transcription factor 16
TrEMBLA0A0J8CCQ90.0A0A0J8CCQ9_BETVU; Uncharacterized protein
STRINGGLYMA09G34170.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35530.11e-139basic region/leucine zipper transcription factor 16